PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco012428.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family MIKC_MADS
Protein Properties Length: 358aa    MW: 39441.4 Da    PI: 8.2907
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco012428.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.23.4e-31959151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 krienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+i+fs++gklyeys+
  Aco012428.1  9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLYEYST 59
                 79***********************************************96 PP

2K-box105.37.6e-3584173998
        K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                    e++  s+++++ kLk+++e+Lq++qR+l+Ge+L+sL+lkeLqqLeqqL+++l++iRs+Kn+ll+++i+elqkkek+lqe+n+aL+k +
  Aco012428.1  84 YPESQVGSWCEDYGKLKSKVESLQKKQRNLMGEQLDSLTLKELQQLEQQLDTALRHIRSRKNQLLFDSISELQKKEKSLQEQNNALEKLM 173
                  6788999*******************************************************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.2E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.17161IPR002100Transcription factor, MADS-box
CDDcd002652.17E-40273No hitNo description
SuperFamilySSF554558.89E-32280IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-30323IPR002100Transcription factor, MADS-box
PfamPF003191.7E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-303859IPR002100Transcription factor, MADS-box
PfamPF014865.1E-2988171IPR002487Transcription factor, K-box
PROSITE profilePS5129716.55489181IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010154Biological Processfruit development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MGRGPVQLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD AEVALIVFST KGKLYEYSTD  60
TSMERILDRY ERYAYAEKAL SEGYPESQVG SWCEDYGKLK SKVESLQKKQ RNLMGEQLDS  120
LTLKELQQLE QQLDTALRHI RSRKNQLLFD SISELQKKEK SLQEQNNALE KLMEKDAADA  180
DANALTQHLQ WEQQNQPLTS PSPLPFVFTD ALPNSNTGTY QQSDTSCEPG SAEPLINTNS  240
KTLPPWMLRL ANPSATVTRA TPHSFPPSPS SSLLTALGDN NEDGAAFSVS ASASADADAG  300
EELKAGPGEG GANRGDEVVS MFWGSGAACK AKRLTLMRMG LEEKGEKGVK GRGRRRK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P7e-20174173Myocyte-specific enhancer factor 2B
1tqe_Q7e-20174173Myocyte-specific enhancer factor 2B
1tqe_R7e-20174173Myocyte-specific enhancer factor 2B
1tqe_S7e-20174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ5344901e-58DQ534490.1 Triticum aestivum MADS2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008794203.11e-104PREDICTED: MADS-box transcription factor 14-like
SwissprotA2YNI25e-96MAD18_ORYSI; MADS-box transcription factor 18
SwissprotQ0D4T45e-96MAD18_ORYSJ; MADS-box transcription factor 18
TrEMBLH7C8L01e-111H7C8L0_ALSLI; Apetala1/squamosa protein
STRINGGSMUA_Achr4P23540_0011e-102(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP115137113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60910.11e-75AGAMOUS-like 8